PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.8G149500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 363aa    MW: 39104.8 Da    PI: 8.3837
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.8G149500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC70.42.2e-22127171145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         daepgrCrRtDGKkWRCsr++++++k+CErH++r+++rsrk++e+
  Seita.8G149500.1.p 127 DAEPGRCRRTDGKKWRCSRDAVGDQKYCERHIKRNCHRSRKHVES 171
                         79****************************************996 PP

2QLQ57.25.1e-2067103137
                 QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         ++FT++Q+++L++Q+l+yK++a n+PvP+ Ll++i++
  Seita.8G149500.1.p  67 GPFTPTQWMELEHQALIYKHFAVNAPVPSSLLLPIRR 103
                         59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.4E-1267103IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.0E-1468102IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.46468103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.468127171IPR014977WRC domain
PfamPF088792.1E-17128170IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MEAGRDGFLG AAGRASPPPP SCSFLGSATT TGSSGAQMLS FSSSGAAGLG LSSGASKMQG  60
VLSRVRGPFT PTQWMELEHQ ALIYKHFAVN APVPSSLLLP IRRSINPWSG LGSSSLGWTP  120
FRPGPGDAEP GRCRRTDGKK WRCSRDAVGD QKYCERHIKR NCHRSRKHVE SRKATPTIAE  180
PSMAVSGGPS LHSYAVPWQQ QVKSSAATMT DSFSRESNRK LLEKQNVHNQ LSVSAPMDSF  240
DFASSGSSQN RDIVPLSPVE LQHDHDQAYI VHGVGSSAEN GNELQESLLL VSRETLDDGP  300
LGEVFKSKIC QSAYADILTD QWTVTRDLQL SNSNTMPVEN HISSNGYLMA TMVNSQTVPT  360
FL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979454.10.0PREDICTED: growth-regulating factor 8-like
SwissprotQ6AWY11e-144GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLK3ZJC70.0K3ZJC7_SETIT; Uncharacterized protein
STRINGSi026680m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129602731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.13e-41growth-regulating factor 2